PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G2092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 544aa    MW: 61561.7 Da    PI: 6.0255
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G2092genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-09280326652
                  S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
     Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                  +++k q+++Le+++++++ p+ +++  + + ++L+ ++V  WF  +R
  Gh_A08G2092 280 RLKKVQIDTLEKVYRRSKRPTNTMISSIVQVTNLPRKRVVKWFEDKR 326
                  57899***************************************999 PP

2bZIP_1461.2e-14461523163
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  +ke kr +r+ +NR++A+  R+RKka++ eLe++v  Le++N++L ++l++l +e + l++ v
  Gh_A08G2092 461 DKENKRLKRLLRNRVSAQQARERKKAYLNELETRVRDLEKKNSELEERLSTLHNENQMLRQIV 523
                  5899*****************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.944272332IPR001356Homeobox domain
SuperFamilySSF466896.84E-9275337IPR009057Homeodomain-like
CDDcd000869.01E-6275326No hitNo description
SMARTSM003897.8E-5278336IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-8280339IPR009057Homeodomain-like
PfamPF000467.9E-7280326IPR001356Homeobox domain
SMARTSM003381.6E-14461525IPR004827Basic-leucine zipper domain
PfamPF001702.5E-13462523IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.668463526IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.69E-12465523No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-16465525No hitNo description
CDDcd147047.11E-18466517No hitNo description
PROSITE patternPS000360468483IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MASALSVNSS ISVRILQSSS YRGRVSIAQP RSFNLLPAPQ SRRRYTVAFS RRRNNQPAST  60
DKKKRLKKEK KKGLVEEEEE DFEGDPFEAL FKQLEEDLKN DNPDMEDDDD EGDEINEDIE  120
RLANELAEAF GDFDFEGFSS ASNDAEEEVE DDSEEDGNDD DEEERPVKLK NWQLRRLAAA  180
LKVGRRKTSI KTLAAELCLD RAVVLELLRE PPPELLMISA TLPDEPVKKE LEPEPEPEPM  240
PETKHVETLA FETTMDNVKH EPKVKEPIHV MQQRWSAQKR LKKVQIDTLE KVYRRSKRPT  300
NTMISSIVQV TNLPRKRVVK WFEDKRNEDG VPEHRQPYRS SQPAQRGPNS LHPHPLSSHP  360
TVRSIPNQTA IIPPQMQEQG TSSIAASSLP SSSERSSSSA LQVEVKEGME SDEEIRRVPE  420
IGGEASAAPA AGREPGSLTR LDRPQPSGEG GQRKRGRSPA DKENKRLKRL LRNRVSAQQA  480
RERKKAYLNE LETRVRDLEK KNSELEERLS TLHNENQMLR QIVKNTTASR RGGNGSSNAA  540
DGTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_B1e-13486525342Transcription factor HY5
2oqq_A1e-13486525342Transcription factor HY5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14166RRRYTVAFSRRRNNQPASTDKKKRLK
25064RRRNNQPASTDKKKR
36171KKKRLKKEKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.26000.0embryo| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5875561e-96JX587556.1 Gossypium hirsutum clone NBRI_GE21695 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477095.11e-176PREDICTED: protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLA0A0B0MBT90.0A0A0B0MBT9_G
STRINGVIT_04s0008g05190.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.15e-57overexpressor of cationic peroxidase 3